General Information

  • ID:  hor003076
  • Uniprot ID:  Q9D3P9
  • Protein name:  Neurotensin
  • Gene name:  NTS
  • Organism:  Mus musculus (Mouse)
  • Family:  Neurotensin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0008542 visual learning; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0031640 killing of cells of another organism; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle; GO:0043025 neuronal cell body; GO:0043231 intracellular membrane-bounded organelle; GO:0043679 axon terminus

Sequence Information

  • Sequence:  QLYENKPRRPYIL
  • Length:  13
  • Propeptide:  MRGMNLQLVCLTLLAFSSWSLCSDSEEDVRALEADLLTNMHTSKISKASPPSWKMTLLNVCSLINNVNSPAEEAGDMHDDDLVGKRKLPLVLDGFSLEAMLTIFQLQKICRSRAFQHWEIIQEDILDNVNDKNEKEEVIKRKIPYILKRQLYENKPRRPYILKRGSYYY
  • Signal peptide:  MRGMNLQLVCLTLLAFSSWSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Ntsr1
  • Target Unid:  O88319
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A8MRK3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-A8MRK3-F1.pdbhor003076_AF2.pdbhor003076_ESM.pdb

Physical Information

Mass: 190419 Formula: C78H124N22O20
Absent amino acids: ACDFGHMSTVW Common amino acids: LPRY
pI: 10.01 Basic residues: 3
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -131.54 Boman Index: -3990
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 90
Instability Index: 8373.85 Extinction Coefficient cystines: 2980
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  NA
  • Title:  NA